IL6

Predicted MW：49.8kDa

Expression Host：Mammalian cells

Accurate MW：55kDa

Synonyms：IFNB2

Construction：A DNA sequence encoding the human IL6(Met1~Met212) was fused with the C-terminal Fc tag

Organism Species：Homo sapiens (Human)

Uniprot ID：P05231

Fragment：Met1~Met212

Tag：C-terminal Fc tag

Purity：>90% by SDS-PAGE

Endotoxin：< 1.0 EU per μg of the protein as determined by the LAL method.

Shipping：In general, proteins are provided as lyophilized powder/frozen liquid. They are shipped out with dry ice/blue ice unless customers require otherwise.

Applications：SDS-PAGE; WB; ELISA.

Buffer：Protein lyophilized in sterile PBS/Protein store in sterile PBS.

Reconstitution：Reconstitute in PBS to a concentration of 0.1-1.0 mg/mL.Contact with lab get more information.

Stability & Storage：Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.

Sequence：MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM